Product Name:
Tesmorelin (Growth Hormone-Releasing Hormone Analog)
Chemical Information:
- Molecular Formula: C223H370N72O69S
- Molecular Weight: 5195.9 g/mol
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Molecular Structure:
Product Description:
Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) and is commonly utilized in biochemical and molecular research involving peptide–receptor interactions and signaling pathway analysis. In controlled laboratory settings, it is studied for its interaction with growth hormone-releasing hormone receptors (GHRH-R) and its role in intracellular signaling mechanisms within endocrine research models under defined in vitro conditions. This material is supplied in lyophilized powder form and is intended strictly for in vitro research and analytical applications.
Research Applications:
Tesmorelin is utilized in controlled research environments to support investigation of:
- Growth hormone-releasing hormone receptor (GHRH-R) binding and signaling pathway analysis in isolated cell-based or cell-free in vitro assay systems
- Peptide–receptor interaction dynamics in endocrine signaling models
- Intracellular signaling cascade evaluation associated with peptide ligands
- Structure-function relationships of GHRH-derived peptide analogs
- Stability, degradation, and analytical profiling in assay-based systems
All research applications are conducted in non-human, non-clinical experimental settings.
Storage and Handling:
- Store lyophilized material at −20°C (−4°F)
- After reconstitution, store at 2–8°C (36–46°F) and use promptly
- Avoid repeated freeze-thaw cycles
- Maintain aseptic laboratory handling procedures
Product Specifications:
- Purity: ≥99% (HPLC Certified)
- Appearance: Lyophilized white powder
- Solubility: Soluble in suitable laboratory agents
Compliance Notice:
Tesmorelin is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.
Jemo Chemicals B.V. – API-Grade Peptide Sourcing
Wholesale & bulk supply only.
- GMP-compliant manufacturing
- COA provided (>99% purity)
- Private label available
- Global fulfillment
Research use only. Not for human consumption.
API-grade peptide supplied by Jemo Chemicals B.V.
Sourced from audited GMP-compliant manufacturers. Each batch includes a Certificate of Analysis (COA) confirming purity, identity, and consistency.
We support wholesale procurement, private labeling, bulk kits, and international fulfillment.
This product is intended strictly for laboratory research use only. Not for human consumption.
