Product Name:
FOXO4-DRI (FOXO4 D-Retro-Inverso)
Chemical Information:
- Molecular Formula: C228H388N86O64
- Molecular Weight: ~5358 g/mol
- Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids; retro-inverso)
- Structure Class: Synthetic peptide (D-retro-inverso configuration)
Molecular Structure:
Product Description:
FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.
Research Applications:
FOXO4-DRI is utilized in controlled laboratory research settings for applications such as:
- Evaluation of D-retro-inverso peptide behavior in stability and interaction assays
- Investigation of peptide–protein binding interactions in defined assay systems
- Comparative analysis of L- and D-configured peptide structures under controlled conditions
- Development of in vitro assay systems for studying peptide interaction characteristics
Storage and Handling:
- Store lyophilized powder at −20 °C until use
- Once reconstituted, store at 2–8 °C and use promptly
- Maintain aseptic technique during handling
Product Specifications:
- Purity: ≥99% (HPLC/LC-MS Verified)
- Appearance: Lyophilized white powder
- Solubility: Soluble in suitable laboratory agents
Compliance Notice:
FOXO4-DRI is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.
Jemo Chemicals B.V. – API-Grade Peptide Sourcing
Wholesale & bulk supply only.
- GMP-compliant manufacturing
- COA provided (>99% purity)
- Private label available
- Global fulfillment
Research use only. Not for human consumption.
API-grade peptide supplied by Jemo Chemicals B.V.
Sourced from audited GMP-compliant manufacturers. Each batch includes a Certificate of Analysis (COA) confirming purity, identity, and consistency.
We support wholesale procurement, private labeling, bulk kits, and international fulfillment.
This product is intended strictly for laboratory research use only. Not for human consumption.
